PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn218351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 232aa    MW: 25768.9 Da    PI: 5.3408
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn218351genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.48.6e-30110163155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wtp+LH+rFve+v++L G  +A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Achn218351 110 RPRLVWTPQLHKRFVEVVKHL-GVGNAVPKTIMQLMNVEGLTRENVASHLQKYRL 163
                 59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.797107166IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-30108168IPR009057Homeodomain-like
SuperFamilySSF466893.76E-20109167IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23111163IPR006447Myb domain, plants
PfamPF002493.3E-9113162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGEEVRMSDY DGDDRVYEWE VGLPSADDLT PLSQPLISPE MASAFSISPE PRRSATDVNR  60
ASQNTLSAIS SSNNFNFKSL NDERSQEEFV EEGDEADLAR EGSDPRKAKR PRLVWTPQLH  120
KRFVEVVKHL GVGNAVPKTI MQLMNVEGLT RENVASHLQK YRLYLKRMQG LSDDGPSSDK  180
LFTSAPPPQM MHMPVIGMAH GNGHMGPYHG FESHRIVVGL ECSGTDLWIT T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-21109168463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010650998.13e-87PREDICTED: transcription factor PCL1
RefseqXP_010650997.13e-87PREDICTED: transcription factor PCL1
RefseqXP_002283159.13e-87PREDICTED: transcription factor PCL1
SwissprotQ9SNB42e-71PCL1_ARATH; Transcription factor LUX
TrEMBLF6GUZ03e-87F6GUZ0_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g05120.t019e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.37e-72G2-like family protein